Everything below concerns proteolysis. We keep the language plain, cite what the science says, and separate well-supported claims from open questions.
Updated 2025-08-24. Numbers and descriptions here follow the published literature rather than marketing material.
Most published work on selank originates from a small number of research groups in the Russian Federation. A large share of that record appears in Russian-language journals, which limits access for readers who rely on English-indexed databases. Independent replication by laboratories outside the original research network is sparse in publicly available sources. This concentration of origin and language is a frequently noted feature when the compound is summarized in broader reviews of synthetic peptides.
Reported pharmacological effects center on reduced anxiety-like behavior in animal models and on measures of memory and learning. Proposed contributing mechanisms include modulation of GABAergic signaling, shifts in monoamine turnover, and changes in the activity of enzymes that degrade neuropeptides. Effects on the expression of genes linked to neuroplasticity have also been described. No single molecular target is widely accepted, and whether the behavioral findings arise from one pathway or several remains an open question.
Outside its country of origin the compound is generally handled as a research chemical rather than an approved medicine. No regulatory approval from the United States Food and Drug Administration or the European Medicines Agency has been granted for human use. Identity and purity are normally checked by reverse-phase high-performance liquid chromatography, with mass spectrometry used to confirm the molecular mass. Lyophilised material is stored cold and desiccated, and repeated freeze-thaw cycles are avoided.
Published work on this peptide almost always uses intranasal delivery, with drops or a spray applied to the nasal mucosa. Some animal experiments have used subcutaneous or intraperitoneal injection, and a smaller number have compared routes directly. Oral administration is not a focus of the literature, because short peptides of this size are broken down by digestive enzymes and cross intestinal barriers poorly. How much of an intranasal dose reaches the bloodstream intact in humans remains an open question.
| Property | Value | Notes |
|---|---|---|
| Molecular formula | C33H57N11O9 | Derived from the seven-residue sequence |
| Molecular weight | About 751.9 g/mol | Average mass; the monoisotopic value is slightly lower |
| Residue count | Seven amino acids | Thr-Lys-Pro-Arg-Pro-Gly-Pro |
| Parent compound | Tuftsin (Thr-Lys-Pro-Arg) | Selank extends tuftsin at the C-terminus |
| Compound class | Synthetic short peptide | Studied in a research setting; not a licensed drug in most markets |
Quality assessment of Selank samples typically combines purity determination with identity confirmation and counter-ion analysis. Purity is usually reported as a percentage by chromatographic area, with values above 95 percent often quoted for research-grade material. Water content and residual solvents are checked in lyophilized batches because they affect both stability and accurate mass determination. A reported purity figure does not by itself establish that a sample is the intended sequence, so orthogonal methods are needed to rule out sequence isomers or truncation products.
Characterization of Selank in laboratory settings relies on standard peptide analytical techniques. Reverse-phase high-performance liquid chromatography separates the peptide from related impurities and degradation products, while mass spectrometry confirms molecular identity through accurate mass measurement. Amino acid analysis and peptide sequencing verify the primary structure when reference material is unavailable. Because Selank is a short chain, fragmentation-based analysis produces a diagnostic ion pattern that supports confident identification.
Lyophilised material kept dry at minus 20 degrees Celsius or colder is the most stable form, and suppliers commonly state a shelf life of two years or more under those conditions. Once dissolved, degradation accelerates through hydrolysis and deamidation, particularly at alkaline pH or elevated temperature. Working solutions are usually divided into single-use aliquots to avoid repeated freeze-thaw cycles. The choice of reconstitution solvent affects both stability and the ionic strength of the final preparation.
Reverse-phase high-performance liquid chromatography with ultraviolet detection near 214 nanometres is the standard purity method. Mass spectrometry, typically electrospray ionisation, confirms identity through the expected mass-to-charge pattern. Amino acid analysis can verify composition independently. Chiral purity requires separate techniques such as derivatisation followed by chromatographic separation, and such data are rarely reported for research-grade material.
Quantification in biological matrices relies on liquid chromatography coupled to tandem mass spectrometry with stable-isotope internal standards. Low plasma concentrations and adsorption to container surfaces both complicate measurement. Solid-phase extraction is often needed to reduce matrix interference before injection. Reported limits of quantification differ widely between laboratories, which makes direct comparison of pharmacokinetic results difficult and limits meta-analysis.
Regulatory treatment varies by jurisdiction. In Russia the compound is a registered prescription product, while in the European Union and the United States it is generally handled as a research chemical without a marketing authorization. Suppliers therefore operate outside pharmaceutical oversight, and buyers rely on supplier documentation for purity and identity claims. Chain of custody and third-party testing are the main verification tools. Analysts note that the absence of a pharmacopoeial monograph for research-grade material limits standardization across vendors.
Purity assessment relies mainly on reverse-phase high-performance liquid chromatography with ultraviolet detection. Because the peptide lacks a strong chromophore, detection often uses backbone absorbance near 214 nm. Identity is confirmed by mass spectrometry, typically electrospray ionization or matrix-assisted laser desorption, comparing the measured mass against the expected value. Amino acid analysis can verify composition after acid hydrolysis. Diastereomer content and residual counterions are reported less often, although both can influence biological assays.
Lyophilized material is generally stable for extended periods when kept dry at or below minus twenty degrees Celsius. Working solutions are less stable, and common practice is to aliquot and freeze them so that repeated freeze-thaw cycles are avoided. Aqueous solutions are sensitive to pH extremes and to microbial growth, so short-term storage at refrigerator temperature is typical. Oxidation and hydrolysis are the principal degradation routes. Reconstitution with sterile water or a mild buffer is standard, and solutions should be protected from light.
Finally, the two pieces are combined by pigC and its cofactor adenosine triphosphate (ATP) in a dehydration reaction which establishes a conjugated system across all three rings and completes the synthesis of prodigiosin.
== Other instrumentation == Major pumps and compressors are provided with vibration sensors (VT) to give operating personnel a warning (VA) of potential mechanical problems with the machine. Rupture discs (PSE) and pressure safety valves (PSV) are self-actuated and provide no immediate indication that they have ruptured or lifted. Instrumentation such as pressure alarms (PXA) or movement alarms (PZA) may be fitted to indicate that they have operated. Corrosion coupons and corrosion probes provide a local indication of corrosion rates of fluids flowing in piping.
==== Metabolic block ==== Nerve function depends on its blood supply. Arresting or inhibiting the blood supply can deprive nerve tissue of oxygen and other essential nutrients to induce a metabolic block, whereby the nerve is unable to function. This block is purely a physiologic problem such that the structure of the nerve is unchanged. If the metabolic block is short in duration, it is completely reversible with no permanent effects. An example of a metabolic block is when a limb "falls asleep" (temporary numbness, paresthesia, and weakness) due to the position of a limb that restricts blood flow. Complete ischema, such as the application of a tourniquet, is followed by hyperexcitability and then loss of nerve function over 60-90 minutes. The ischema is immediately reversible when the block is released, as long as the duration of ischema is not too long, such as 1-2 hours. The first sign of impairment to intraneural blood flow occurs in the epineural blood vessels at about 20-30mm Hg pressure. At pressures of 60-80mmHg there will be complete ischemia. A metabolic block can also be induced by stretching. In animal studies, venous statis was seen at an 8% stretch and at a 15% stretch the blood supply was completely arrested. It's a frequent occurrence that patients receiving a nerve decompression see an immediate improvement in their symptoms, and this is thought to be the restoration of blood flow after a metabolic block as other forms of functional nerve impairment such as neuropraxia and axonmetesis take longer to recover.
== Clinical signficance == Many studies have indicated a key role of STAT5a in leukemia, breast, colon, head and neck, and prostate cancer. Until recently, the unique characteristics and function of STAT5a in these cancers have not been delineated from STAT5b, and more research into their differential behavior is warranted. Because of its integral role in immune cell development, STAT5a may contribute to tumor development by compromising immune surveillance. STAT5a expression has been studied closely in prostate and breast cancer, and has only recently shown some promise with colorectal and head and neck cancer. Unphosphorylated or inactive STAT5a may suppress tumor growth in colorectal cancer and active STAT5a expression in premalignant and tumor lesions has shown potential as a prognostic marker in oral squamous cell carcinoma.
1993/974) Road Traffic Act 1991 (Commencement No. 6) Order 1993 (S.I. 1993/975) Protection of Wrecks (Designation No. 1) Order 1993 (S.I. 1993/976) Banking Appeal Tribunal (Amendment) Regulations 1993 (S.I. 1993/982) Building Societies Appeal Tribunal (Amendment) Regulations 1993 (S.I. 1993/983) Building Societies (Prescribed Contracts) Order 1993 (S.I. 1993/984) Building Societies (Designation of Qualifying Bodies) Order 1993 (S.I. 1993/985) Sale of Registration Marks (Amendment) Regulations 1993 (S.I. 1993/986) Retention of Registration Marks Regulations 1993 (S.I. 1993/987) Retention of Registration Marks Regulations 1992 (Amendment) Regulations 1993 (S.I. 1993/988) Building Societies (Designation of Qualifying Bodies) (No. 2) Order 1993 (S.I. 1993/989) Animals, Meat and Meat Products (Examination for Residues and Maximum Residue Limits) (Amendment) Regulations 1993 (S.I. 1993/990) Tayside Region (Electoral Arrangements) Order 1993 (S.I. 1993/991) Dumfries and Galloway Region (Electoral Arrangements) Order 1993 (S.I. 1993/992) National Health Service (Appointment of Consultants) (Scotland) Regulations 1993 (S.I. 1993/994) Assured Tenancies (Exceptions) (Scotland) Amendment Regulations 1993 (S.I. 1993/995) Environmentally Sensitive Areas (Central Southern Uplands) Designation Order 1993 (S.I. 1993/996) Environmentally Sensitive Areas (Western Southern Uplands) Designation Order 1993 (S.I. 1993/997) Education (School Curriculum and Related Information) (Amendment) (Wales) Regulations 1993 (S.I. 1993/998)
Sources: en.wikipedia.org
Potassium alum, potash alum, or potassium aluminium sulfate is a chemical compound defined as the double sulfate of potassium and aluminium, with chemical formula KAl(SO4)2. It is commonly encountered as the dodecahydrate, KAl(SO4)2·12H2O. It crystallizes in an octahedral structure in neutral solution and cubic structure in an alkali solution with space group Pa3 and lattice parameter of 12.18 Å. The compound is the most important member of the generic class of compounds called alums, and is often called simply alum. Potassium alum is commonly used in water purification, leather tanning, dyeing, fireproof textiles, and baking powder as E number E522. It also has cosmetic uses as a deodorant, as an aftershave treatment and as a styptic for minor bleeding from shaving.
Dinosaurs diverged from their archosaur ancestors during the Middle to Late Triassic epochs, roughly 20 million years after the devastating Permian–Triassic extinction event wiped out an estimated 96% of all marine species and 70% of terrestrial vertebrate species approximately 252 million years ago. The oldest dinosaur fossils known from substantial remains date to the Carnian epoch of the Triassic period and have been found primarily in the Ischigualasto and Santa Maria Formations of Argentina and Brazil, and the Pebbly Arkose Formation of Zimbabwe. The Ischigualasto Formation (radiometrically dated at 231–230 million years old) has produced the early saurischian Eoraptor, originally considered a member of the Herrerasauridae but now considered to be an early sauropodomorph, along with the herrerasaurids Herrerasaurus and Sanjuansaurus, and the sauropodomorphs Chromogisaurus, Eodromaeus, and Panphagia. Eoraptor's likely resemblance to the common ancestor of all dinosaurs suggests that the first dinosaurs would have been small, bipedal predators. The Santa Maria Formation (radiometrically dated to be older, at 233.23 million years old) has produced the herrerasaurids Gnathovorax and Staurikosaurus, along with the sauropodomorphs Bagualosaurus, Buriolestes, Guaibasaurus, Macrocollum, Nhandumirim, Pampadromaeus, Saturnalia, and Unaysaurus. The Pebbly Arkose Formation, which is of uncertain age but was likely comparable to the other two, has produced the sauropodomorph Mbiresaurus, along with an unnamed herrerasaurid.
{\displaystyle T\leq {\frac {abc}{2}}{\sqrt {\frac {a+b+c}{a^{3}+b^{3}+c^{3}+abc}}}\leq {\frac {1}{4}}{\sqrt[{6}]{\frac {3(a+b+c)^{3}(abc)^{4}}{a^{3}+b^{3}+c^{3}}}}\leq {\frac {\sqrt {3}}{4}}(abc)^{\frac {2}{3}}.}
According to the 1996 edition of Vogel's Textbook, yields close to 100% are called quantitative, yields above 90% are called excellent, yields above 80% are very good, yields above 70% are good, yields above 50% are fair, and yields below 40% are called poor. In their 2002 publication, Petrucci, Harwood, and Herring wrote that Vogel's Textbook names were arbitrary, and not universally accepted, and depending on the nature of the reaction in question, these expectations may be unrealistically high. Yields may appear to be 100% or above when products are impure, as the measured weight of the product will include the weight of any impurities. In their 2016 laboratory manual, Experimental Organic Chemistry, the authors described the "reaction yield" or "absolute yield" of a chemical reaction as the "amount of pure and dry product yielded in a reaction". They wrote that knowing the stoichiometry of a chemical reaction—the numbers and types of atoms in the reactants and products, in a balanced equation "make it possible to compare different elements through stoichiometric factors." Ratios obtained by these quantitative relationships are useful in data analysis.
Lepirudin is an anticoagulant that functions as a direct thrombin inhibitor. Brand name: Refludan, Generic: Lepirudin rDNA for injection. Lepirudin is a recombinant hirudin derived from yeast cells. Lepirudin is almost identical to hirudin extracted from Hirudo medicinalis, having the amino acid sequence LTYTDCTESGQNLCLCEGSNVCGQGNKCILGSDGEKNQCVTGEGTPKPQSHNDGDFEEIPEEYLQ with disulfide bridges at Cys6-Cys14, Cys16-Cys28 and Cys22-Cys39, and differs from by the substitution of leucine for isoleucine at the N-terminal end of the molecule and the absence of a sulfate group on the tyrosine at position 63. Lepirudin may be used as an anticoagulant when heparins (unfractionated or low-molecular-weight) are contraindicated because of heparin-induced thrombocytopenia.
Sources: en.wikipedia.org
=== Round-trip efficiency === The table below shows the result of an experimental evaluation of a "high-energy" type 3.0 Ah 18650 NMC cell in 2021, round-trip efficiency which compared the energy going into the cell and energy extracted from the cell from 100% (4.2v) SoC to 0% SoC (cut off 2.0v). A round-trip efficiency is the percent of energy that can be used relative to the energy that went into charging the battery.
Severity of injury found on imaging will determine whether the surgeon takes an operative or close observational approach. Diagnostic peritoneal lavage (DPL) has become largely obsolete with the advances in MDCT, with use limited to centers without access to CT to guide requirement for urgent transfer for operation.
The fruits are eaten fresh or made into jams, fools, juices, or pies. In France and Italy, they are used as a base for liqueurs and are a popular flavoring for sorbets and other desserts. In Brittany, they are often used as a flavoring for crêpes. In the Vosges and the Massif Central, bilberry tart (tarte aux myrtilles) is a traditional dessert. In Romania, they are used as a base for a liqueur called afinată – the name of the fruit in Romanian is afină. In Nordic countries, they are eaten fresh or made into jams and other dishes, including bilberry pie (Finnish mustikkapiirakka, Swedish blåbärspaj) and blåbärssoppa, a bilberry soup served hot or cold. In Iceland, they are eaten with skyr (a cultured dairy product similar to yoghurt). In Poland, they are eaten fresh (often mixed with sugar), as a filling in a sweet yeast-leavened bun known as jagodzianka, in jams, and with śmietana.
Acoustic and seismic metamaterials are also research areas. Metamaterial research is interdisciplinary and involves such fields as electrical engineering, electromagnetics, classical optics, solid state physics, microwave and antenna engineering, optoelectronics, material sciences, nanoscience and semiconductor engineering. Recent developments also suggest potential applications of metamaterials in optical computing, with metamaterial-based systems theoretically being able to perform certain tasks more efficiently than conventional computing.
=== 21 March === The SAF retook the Republican Palace in Khartoum from the RSF. An RSF drone strike on the palace that same day killed six journalists including two military reporters and four members of a Sudan TV crew.
Sources: en.wikipedia.org
Selank is a synthetic heptapeptide with the sequence Thr-Lys-Pro-Arg-Pro-Gly-Pro, designed as a metabolically stabilized analogue of the endogenous tetrapeptide tuftsin. It has been studied mainly against anxiety-related and cognitive endpoints rather than as an approved medicine in most jurisdictions.
Tuftsin contains four residues, while selank carries an additional Pro-Gly-Pro segment at the carboxyl end. That extension is intended to reduce enzymatic cleavage. Comparative pharmacokinetic data in humans remain limited.
No single receptor target is widely accepted as the definitive mediator of the reported effects. Proposed contributors include GABAergic modulation, shifts in monoamine turnover, and altered neuropeptide degradation. The mechanism is treated in the literature as unresolved.
Most published work uses intranasal application, either as drops or as a nasal spray. Injection routes appear in a smaller set of animal experiments. Oral use is uncommon in the literature because peptide breakdown and poor absorption limit this route.